Placeholder image of a protein
Icon representing a puzzle

2501: Refine Density Reconstruction 4

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 28, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2137, which was Reconstruction Puzzle 7, but now we have the Refine Density tool available to make folds even better! Learn about the new tool here: https://fold.it/forum/blog/new-tool-refine-density. This one won't allow loading solutions from that puzzle.

Sequence
TAAAKFERQHMDSPDLGTDDDDKAMADIGSDFMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEAHND

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,171
  2. Avatar for Go Science 2. Go Science 65 pts. 19,948
  3. Avatar for Contenders 3. Contenders 41 pts. 19,761
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 19,592
  5. Avatar for Team China 5. Team China 14 pts. 19,416
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 19,371
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 19,340
  8. Avatar for Australia 8. Australia 2 pts. 19,084
  9. Avatar for VeFold 9. VeFold 1 pt. 18,864
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 18,370

  1. Avatar for Merf 51. Merf Lv 1 1 pt. 15,745
  2. Avatar for KRUK94 52. KRUK94 Lv 1 1 pt. 15,271
  3. Avatar for Deleted player 53. Deleted player pts. 15,075
  4. Avatar for BlueCat74 54. BlueCat74 Lv 1 1 pt. 14,973
  5. Avatar for Funk3Beast 55. Funk3Beast Lv 1 1 pt. 14,806
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 14,759
  7. Avatar for Arne Heessels 57. Arne Heessels Lv 1 1 pt. 14,587
  8. Avatar for aicasab 58. aicasab Lv 1 1 pt. 14,541
  9. Avatar for mwm64 59. mwm64 Lv 1 1 pt. 14,529
  10. Avatar for nancy_naniewoo 60. nancy_naniewoo Lv 1 1 pt. 14,244

Comments