Icon representing a puzzle

2502: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
August 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 10,404
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,101
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,652

  1. Avatar for zbp 41. zbp Lv 1 2 pts. 10,227
  2. Avatar for aicasab 42. aicasab Lv 1 1 pt. 10,200
  3. Avatar for hada 43. hada Lv 1 1 pt. 10,179
  4. Avatar for Hellcat6 44. Hellcat6 Lv 1 1 pt. 10,135
  5. Avatar for mwm64 45. mwm64 Lv 1 1 pt. 10,101
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 1 pt. 10,087
  7. Avatar for Artoria2e5 47. Artoria2e5 Lv 1 1 pt. 10,065
  8. Avatar for heather-1 48. heather-1 Lv 1 1 pt. 10,058
  9. Avatar for pizpot 49. pizpot Lv 1 1 pt. 10,037
  10. Avatar for carxo 50. carxo Lv 1 1 pt. 10,002

Comments