Icon representing a puzzle

2502: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,008
  2. Avatar for Go Science 2. Go Science 65 pts. 10,920
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 41 pts. 10,776
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,681
  5. Avatar for Contenders 5. Contenders 14 pts. 10,680
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,606
  7. Avatar for Australia 7. Australia 4 pts. 10,572
  8. Avatar for VeFold 8. VeFold 2 pts. 10,565
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,557
  10. Avatar for Team China 10. Team China 1 pt. 10,524
  1. Avatar for zbp 41. zbp Lv 1 2 pts. 10,227
  2. Avatar for aicasab 42. aicasab Lv 1 1 pt. 10,200
  3. Avatar for hada 43. hada Lv 1 1 pt. 10,179
  4. Avatar for Hellcat6 44. Hellcat6 Lv 1 1 pt. 10,135
  5. Avatar for mwm64 45. mwm64 Lv 1 1 pt. 10,101
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 1 pt. 10,087
  7. Avatar for Artoria2e5 47. Artoria2e5 Lv 1 1 pt. 10,065
  8. Avatar for heather-1 48. heather-1 Lv 1 1 pt. 10,058
  9. Avatar for pizpot 49. pizpot Lv 1 1 pt. 10,037
  10. Avatar for carxo 50. carxo Lv 1 1 pt. 10,002

Comments