Icon representing a puzzle

2502: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 10,404
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,101
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,652
  1. Avatar for frostschutz 51. frostschutz Lv 1 1 pt. 9,984
  2. Avatar for maithra 52. maithra Lv 1 1 pt. 9,965
  3. Avatar for Mohoernchen 53. Mohoernchen Lv 1 1 pt. 9,964
  4. Avatar for Trajan464 54. Trajan464 Lv 1 1 pt. 9,962
  5. Avatar for ppp6 55. ppp6 Lv 1 1 pt. 9,908
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 9,897
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 9,869
  8. Avatar for Hexafluorouranate 58. Hexafluorouranate Lv 1 1 pt. 9,826
  9. Avatar for BlueCat74 59. BlueCat74 Lv 1 1 pt. 9,826
  10. Avatar for KRUK94 60. KRUK94 Lv 1 1 pt. 9,789

Comments