Icon representing a puzzle

2502: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,008
  2. Avatar for Go Science 2. Go Science 65 pts. 10,920
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 41 pts. 10,776
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,681
  5. Avatar for Contenders 5. Contenders 14 pts. 10,680
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,606
  7. Avatar for Australia 7. Australia 4 pts. 10,572
  8. Avatar for VeFold 8. VeFold 2 pts. 10,565
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,557
  10. Avatar for Team China 10. Team China 1 pt. 10,524
  1. Avatar for frostschutz 51. frostschutz Lv 1 1 pt. 9,984
  2. Avatar for maithra 52. maithra Lv 1 1 pt. 9,965
  3. Avatar for Mohoernchen 53. Mohoernchen Lv 1 1 pt. 9,964
  4. Avatar for Trajan464 54. Trajan464 Lv 1 1 pt. 9,962
  5. Avatar for ppp6 55. ppp6 Lv 1 1 pt. 9,908
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 9,897
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 9,869
  8. Avatar for Hexafluorouranate 58. Hexafluorouranate Lv 1 1 pt. 9,826
  9. Avatar for BlueCat74 59. BlueCat74 Lv 1 1 pt. 9,826
  10. Avatar for KRUK94 60. KRUK94 Lv 1 1 pt. 9,789

Comments