Icon representing a puzzle

2502: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,008
  2. Avatar for Go Science 2. Go Science 65 pts. 10,920
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 41 pts. 10,776
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,681
  5. Avatar for Contenders 5. Contenders 14 pts. 10,680
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,606
  7. Avatar for Australia 7. Australia 4 pts. 10,572
  8. Avatar for VeFold 8. VeFold 2 pts. 10,565
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,557
  10. Avatar for Team China 10. Team China 1 pt. 10,524
  1. Avatar for Zhang Ruichong 21. Zhang Ruichong Lv 1 18 pts. 10,524
  2. Avatar for drumpeter18yrs9yrs 22. drumpeter18yrs9yrs Lv 1 16 pts. 10,519
  3. Avatar for JuliaBCollet 23. JuliaBCollet Lv 1 15 pts. 10,517
  4. Avatar for akaaka 24. akaaka Lv 1 13 pts. 10,494
  5. Avatar for BootsMcGraw 25. BootsMcGraw Lv 1 12 pts. 10,471
  6. Avatar for Alistair69 26. Alistair69 Lv 1 11 pts. 10,419
  7. Avatar for zo3xiaJonWeinberg 27. zo3xiaJonWeinberg Lv 1 9 pts. 10,406
  8. Avatar for bravosk8erboy 28. bravosk8erboy Lv 1 8 pts. 10,405
  9. Avatar for zanbato 29. zanbato Lv 1 8 pts. 10,404
  10. Avatar for carsonfb 30. carsonfb Lv 1 7 pts. 10,399

Comments