Placeholder image of a protein
Icon representing a puzzle

2514: Refine Density Reconstruction 8

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
September 19, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2237, which was Reconstruction Puzzle 19, but now we have the Refine Density tool available to make folds even better!

Sequence
MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

Top groups

  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 21,691
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 15,369
  3. Avatar for CBME5920_2022 13. CBME5920_2022 1 pt. 0
  4. Avatar for CBE_ProEn_2025 14. CBE_ProEn_2025 1 pt. 0
  1. Avatar for Trajan464 31. Trajan464 Lv 1 6 pts. 21,593
  2. Avatar for pizpot 32. pizpot Lv 1 5 pts. 21,486
  3. Avatar for ProfVince 33. ProfVince Lv 1 4 pts. 21,387
  4. Avatar for Mohoernchen 34. Mohoernchen Lv 1 4 pts. 21,386
  5. Avatar for Alistair69 35. Alistair69 Lv 1 3 pts. 21,309
  6. Avatar for carxo 36. carxo Lv 1 3 pts. 21,179
  7. Avatar for hada 37. hada Lv 1 3 pts. 20,964
  8. Avatar for rinze 38. rinze Lv 1 2 pts. 20,858
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 2 pts. 20,811
  10. Avatar for turbolag 40. turbolag Lv 1 2 pts. 20,795

Comments