Placeholder image of a protein
Icon representing a puzzle

2514: Refine Density Reconstruction 8

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
September 19, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2237, which was Reconstruction Puzzle 19, but now we have the Refine Density tool available to make folds even better!

Sequence
MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 25,059
  2. Avatar for Contenders 2. Contenders 68 pts. 24,682
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 24,248
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 23,898
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 23,661
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 23,414
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 22,877
  8. Avatar for VeFold 8. VeFold 3 pts. 22,677
  9. Avatar for Australia 9. Australia 1 pt. 22,535
  10. Avatar for Russian team 10. Russian team 1 pt. 22,407
  1. Avatar for Trajan464 31. Trajan464 Lv 1 6 pts. 21,593
  2. Avatar for pizpot 32. pizpot Lv 1 5 pts. 21,486
  3. Avatar for ProfVince 33. ProfVince Lv 1 4 pts. 21,387
  4. Avatar for Mohoernchen 34. Mohoernchen Lv 1 4 pts. 21,386
  5. Avatar for Alistair69 35. Alistair69 Lv 1 3 pts. 21,309
  6. Avatar for carxo 36. carxo Lv 1 3 pts. 21,179
  7. Avatar for hada 37. hada Lv 1 3 pts. 20,964
  8. Avatar for rinze 38. rinze Lv 1 2 pts. 20,858
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 2 pts. 20,811
  10. Avatar for turbolag 40. turbolag Lv 1 2 pts. 20,795

Comments