Placeholder image of a protein
Icon representing a puzzle

2514: Refine Density Reconstruction 8

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
September 19, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2237, which was Reconstruction Puzzle 19, but now we have the Refine Density tool available to make folds even better!

Sequence
MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

Top groups

  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 21,691
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 15,369
  3. Avatar for CBME5920_2022 13. CBME5920_2022 1 pt. 0
  4. Avatar for CBE_ProEn_2025 14. CBE_ProEn_2025 1 pt. 0
  1. Avatar for zbp 41. zbp Lv 1 2 pts. 20,743
  2. Avatar for RealPerson 42. RealPerson Lv 1 1 pt. 20,120
  3. Avatar for mart0258 43. mart0258 Lv 1 1 pt. 19,805
  4. Avatar for BlueCat74 44. BlueCat74 Lv 1 1 pt. 19,792
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 1 pt. 18,422
  6. Avatar for roarshock 46. roarshock Lv 1 1 pt. 18,279
  7. Avatar for jamiexq 47. jamiexq Lv 1 1 pt. 18,235
  8. Avatar for maithra 48. maithra Lv 1 1 pt. 18,030
  9. Avatar for Merf 49. Merf Lv 1 1 pt. 17,871
  10. Avatar for nicobul 50. nicobul Lv 1 1 pt. 17,578

Comments