Placeholder image of a protein
Icon representing a puzzle

2514: Refine Density Reconstruction 8

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
September 19, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2237, which was Reconstruction Puzzle 19, but now we have the Refine Density tool available to make folds even better!

Sequence
MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 25,059
  2. Avatar for Contenders 2. Contenders 68 pts. 24,682
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 24,248
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 23,898
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 23,661
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 23,414
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 22,877
  8. Avatar for VeFold 8. VeFold 3 pts. 22,677
  9. Avatar for Australia 9. Australia 1 pt. 22,535
  10. Avatar for Russian team 10. Russian team 1 pt. 22,407
  1. Avatar for zbp 41. zbp Lv 1 2 pts. 20,743
  2. Avatar for RealPerson 42. RealPerson Lv 1 1 pt. 20,120
  3. Avatar for mart0258 43. mart0258 Lv 1 1 pt. 19,805
  4. Avatar for BlueCat74 44. BlueCat74 Lv 1 1 pt. 19,792
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 1 pt. 18,422
  6. Avatar for roarshock 46. roarshock Lv 1 1 pt. 18,279
  7. Avatar for jamiexq 47. jamiexq Lv 1 1 pt. 18,235
  8. Avatar for maithra 48. maithra Lv 1 1 pt. 18,030
  9. Avatar for Merf 49. Merf Lv 1 1 pt. 17,871
  10. Avatar for nicobul 50. nicobul Lv 1 1 pt. 17,578

Comments