Icon representing a puzzle

2513: Revisiting Puzzle 73: Polycystein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
September 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 9,243
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 9,235
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 8,529
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,161
  1. Avatar for JuliaBCollet 41. JuliaBCollet Lv 1 2 pts. 9,441
  2. Avatar for maithra 42. maithra Lv 1 2 pts. 9,399
  3. Avatar for hada 43. hada Lv 1 2 pts. 9,366
  4. Avatar for pfirth 44. pfirth Lv 1 1 pt. 9,296
  5. Avatar for carxo 45. carxo Lv 1 1 pt. 9,291
  6. Avatar for frostschutz 46. frostschutz Lv 1 1 pt. 9,251
  7. Avatar for Ilya 47. Ilya Lv 1 1 pt. 9,248
  8. Avatar for Savas 48. Savas Lv 1 1 pt. 9,243
  9. Avatar for zanbato 49. zanbato Lv 1 1 pt. 9,235
  10. Avatar for Mohoernchen 50. Mohoernchen Lv 1 1 pt. 9,232

Comments