Icon representing a puzzle

2513: Revisiting Puzzle 73: Polycystein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
September 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 9,243
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 9,235
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 8,529
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,161
  1. Avatar for apetrides 61. apetrides Lv 1 1 pt. 8,608
  2. Avatar for orily1337 62. orily1337 Lv 1 1 pt. 8,555
  3. Avatar for AsDawnBreaks 63. AsDawnBreaks Lv 1 1 pt. 8,529
  4. Avatar for Swapper242 64. Swapper242 Lv 1 1 pt. 8,288
  5. Avatar for Sammy3c2b1a0 65. Sammy3c2b1a0 Lv 1 1 pt. 8,161
  6. Avatar for Theo Chopard-Vilhem 66. Theo Chopard-Vilhem Lv 1 1 pt. 8,126
  7. Avatar for aurascoper 67. aurascoper Lv 1 1 pt. 8,084
  8. Avatar for RWoodcock 68. RWoodcock Lv 1 1 pt. 7,871
  9. Avatar for Pain-Thunder 69. Pain-Thunder Lv 1 1 pt. 5,653
  10. Avatar for Anfinsen_slept_here 70. Anfinsen_slept_here Lv 1 1 pt. 4,879

Comments