Icon representing a puzzle

2516: Revisiting Puzzle 74: Platypus Venom

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
October 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,761
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,616
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,362
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,231

  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 51 pts. 9,604
  2. Avatar for fpc 12. fpc Lv 1 47 pts. 9,594
  3. Avatar for drumpeter18yrs9yrs 13. drumpeter18yrs9yrs Lv 1 44 pts. 9,571
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 41 pts. 9,562
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 38 pts. 9,547
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 35 pts. 9,546
  7. Avatar for g_b 17. g_b Lv 1 32 pts. 9,538
  8. Avatar for hookedwarm 18. hookedwarm Lv 1 30 pts. 9,510
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 27 pts. 9,498
  10. Avatar for Galaxie 20. Galaxie Lv 1 25 pts. 9,493

Comments