Placeholder image of a protein
Icon representing a puzzle

2520: Refine Density Reconstruction 9

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 03, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 14,751
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 13,739
  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 46 pts. 15,288
  2. Avatar for Galaxie 12. Galaxie Lv 1 42 pts. 15,284
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 39 pts. 15,275
  4. Avatar for g_b 14. g_b Lv 1 36 pts. 15,228
  5. Avatar for ppp6 15. ppp6 Lv 1 33 pts. 15,194
  6. Avatar for fpc 16. fpc Lv 1 30 pts. 15,130
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 27 pts. 15,113
  8. Avatar for grogar7 18. grogar7 Lv 1 25 pts. 15,099
  9. Avatar for Crossed Sticks 19. Crossed Sticks Lv 1 23 pts. 15,098
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 20 pts. 15,094

Comments