Placeholder image of a protein
Icon representing a puzzle

2520: Refine Density Reconstruction 9

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 03, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 14,751
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 13,739
  1. Avatar for Th1sN@me!sN0tAPun 31. Th1sN@me!sN0tAPun Lv 1 6 pts. 14,845
  2. Avatar for Mohoernchen 32. Mohoernchen Lv 1 6 pts. 14,841
  3. Avatar for zbp 33. zbp Lv 1 5 pts. 14,822
  4. Avatar for JuliaBCollet 34. JuliaBCollet Lv 1 4 pts. 14,818
  5. Avatar for manu8170 35. manu8170 Lv 1 4 pts. 14,805
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 3 pts. 14,798
  7. Avatar for toshiue 37. toshiue Lv 1 3 pts. 14,757
  8. Avatar for alyssa_d_V2.0 38. alyssa_d_V2.0 Lv 1 3 pts. 14,751
  9. Avatar for meatexplosion 39. meatexplosion Lv 1 2 pts. 14,619
  10. Avatar for ProfVince 40. ProfVince Lv 1 2 pts. 14,607

Comments