Placeholder image of a protein
Icon representing a puzzle

2520: Refine Density Reconstruction 9

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 03, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 14,751
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 13,739
  1. Avatar for nancy_naniewoo 51. nancy_naniewoo Lv 1 1 pt. 14,161
  2. Avatar for pfirth 52. pfirth Lv 1 1 pt. 14,035
  3. Avatar for Merf 53. Merf Lv 1 1 pt. 13,928
  4. Avatar for Nandina 54. Nandina Lv 1 1 pt. 13,872
  5. Avatar for The Cleric 55. The Cleric Lv 1 1 pt. 13,855
  6. Avatar for Alistair69 56. Alistair69 Lv 1 1 pt. 13,792
  7. Avatar for drjr 57. drjr Lv 1 1 pt. 13,782
  8. Avatar for Sammy3c2b1a0 58. Sammy3c2b1a0 Lv 1 1 pt. 13,739
  9. Avatar for futsall 59. futsall Lv 1 1 pt. 13,724
  10. Avatar for DScott 60. DScott Lv 1 1 pt. 13,719

Comments