Placeholder image of a protein
Icon representing a puzzle

2520: Refine Density Reconstruction 9

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
October 03, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 14,751
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 13,739

  1. Avatar for Swapper242 61. Swapper242 Lv 1 1 pt. 13,695
  2. Avatar for wosser1 62. wosser1 Lv 1 1 pt. 13,688
  3. Avatar for furi0us 63. furi0us Lv 1 1 pt. 13,656
  4. Avatar for Chemierlee 64. Chemierlee Lv 1 1 pt. 13,578
  5. Avatar for equilibria 65. equilibria Lv 1 1 pt. 13,572
  6. Avatar for ZhaoQianCheng 66. ZhaoQianCheng Lv 1 1 pt. 9,860
  7. Avatar for ivalnic 67. ivalnic Lv 1 1 pt. 9,860
  8. Avatar for oitiniba 68. oitiniba Lv 1 1 pt. 9,860
  9. Avatar for m1n9un 69. m1n9un Lv 1 1 pt. 9,860
  10. Avatar for MsHsi 70. MsHsi Lv 1 1 pt. 9,860

Comments