Placeholder image of a protein
Icon representing a puzzle

2520: Refine Density Reconstruction 9

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 03, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 15,801
  2. Avatar for Go Science 2. Go Science 63 pts. 15,784
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 15,694
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 15,652
  5. Avatar for Contenders 5. Contenders 11 pts. 15,449
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 15,130
  7. Avatar for Australia 7. Australia 2 pts. 15,113
  8. Avatar for Extraterrestrials 2.0 8. Extraterrestrials 2.0 1 pt. 15,018
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 15,000
  10. Avatar for VeFold 10. VeFold 1 pt. 14,902
  1. Avatar for zanbato 21. zanbato Lv 1 19 pts. 15,018
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 17 pts. 15,000
  3. Avatar for alcor29 23. alcor29 Lv 1 15 pts. 14,934
  4. Avatar for akaaka 24. akaaka Lv 1 14 pts. 14,918
  5. Avatar for BarrySampson 25. BarrySampson Lv 1 12 pts. 14,902
  6. Avatar for drumpeter18yrs9yrs 26. drumpeter18yrs9yrs Lv 1 11 pts. 14,889
  7. Avatar for dcrwheeler 27. dcrwheeler Lv 1 10 pts. 14,887
  8. Avatar for rinze 28. rinze Lv 1 9 pts. 14,879
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 8 pts. 14,873
  10. Avatar for Hellcat6 30. Hellcat6 Lv 1 7 pts. 14,864

Comments