Placeholder image of a protein
Icon representing a puzzle

2520: Refine Density Reconstruction 9

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 03, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 15,801
  2. Avatar for Go Science 2. Go Science 63 pts. 15,784
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 15,694
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 15,652
  5. Avatar for Contenders 5. Contenders 11 pts. 15,449
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 15,130
  7. Avatar for Australia 7. Australia 2 pts. 15,113
  8. Avatar for Extraterrestrials 2.0 8. Extraterrestrials 2.0 1 pt. 15,018
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 15,000
  10. Avatar for VeFold 10. VeFold 1 pt. 14,902
  1. Avatar for abiogenesis 41. abiogenesis Lv 1 2 pts. 14,490
  2. Avatar for EIIisTAB2 42. EIIisTAB2 Lv 1 2 pts. 14,418
  3. Avatar for RWoodcock 43. RWoodcock Lv 1 1 pt. 14,386
  4. Avatar for carxo 44. carxo Lv 1 1 pt. 14,368
  5. Avatar for jamiexq 45. jamiexq Lv 1 1 pt. 14,316
  6. Avatar for nicobul 46. nicobul Lv 1 1 pt. 14,297
  7. Avatar for roarshock 47. roarshock Lv 1 1 pt. 14,295
  8. Avatar for Steven Pletsch 48. Steven Pletsch Lv 1 1 pt. 14,270
  9. Avatar for Dr.Sillem 49. Dr.Sillem Lv 1 1 pt. 14,239
  10. Avatar for maithra 50. maithra Lv 1 1 pt. 14,208

Comments