Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 9,819
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,750
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,140
  1. Avatar for maithra 31. maithra Lv 1 12 pts. 9,926
  2. Avatar for Dr.Sillem 32. Dr.Sillem Lv 1 11 pts. 9,926
  3. Avatar for jamiexq 33. jamiexq Lv 1 10 pts. 9,924
  4. Avatar for zanbato 34. zanbato Lv 1 9 pts. 9,910
  5. Avatar for latin krepin 35. latin krepin Lv 1 8 pts. 9,861
  6. Avatar for Hellcat6 36. Hellcat6 Lv 1 8 pts. 9,857
  7. Avatar for pizpot 37. pizpot Lv 1 7 pts. 9,847
  8. Avatar for muffnerk 38. muffnerk Lv 1 6 pts. 9,844
  9. Avatar for Idiotboy 39. Idiotboy Lv 1 6 pts. 9,832
  10. Avatar for zbp 40. zbp Lv 1 5 pts. 9,821

Comments