Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,187
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,175
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 10,137
  4. Avatar for Contenders 4. Contenders 24 pts. 10,092
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 10,080
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,055
  7. Avatar for Australia 7. Australia 4 pts. 10,031
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 10,026
  9. Avatar for VeFold 9. VeFold 1 pt. 9,970
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 9,910
  1. Avatar for maithra 31. maithra Lv 1 12 pts. 9,926
  2. Avatar for Dr.Sillem 32. Dr.Sillem Lv 1 11 pts. 9,926
  3. Avatar for jamiexq 33. jamiexq Lv 1 10 pts. 9,924
  4. Avatar for zanbato 34. zanbato Lv 1 9 pts. 9,910
  5. Avatar for latin krepin 35. latin krepin Lv 1 8 pts. 9,861
  6. Avatar for Hellcat6 36. Hellcat6 Lv 1 8 pts. 9,857
  7. Avatar for pizpot 37. pizpot Lv 1 7 pts. 9,847
  8. Avatar for muffnerk 38. muffnerk Lv 1 6 pts. 9,844
  9. Avatar for Idiotboy 39. Idiotboy Lv 1 6 pts. 9,832
  10. Avatar for zbp 40. zbp Lv 1 5 pts. 9,821

Comments