Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 9,819
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,750
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,140
  1. Avatar for Zhang Ruichong 41. Zhang Ruichong Lv 1 5 pts. 9,819
  2. Avatar for ppp6 42. ppp6 Lv 1 4 pts. 9,812
  3. Avatar for abiogenesis 43. abiogenesis Lv 1 4 pts. 9,811
  4. Avatar for matt61ger 44. matt61ger Lv 1 3 pts. 9,786
  5. Avatar for heather-1 45. heather-1 Lv 1 3 pts. 9,784
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 3 pts. 9,775
  7. Avatar for ivalnic 47. ivalnic Lv 1 3 pts. 9,769
  8. Avatar for Th1sN@me!sN0tAPun 48. Th1sN@me!sN0tAPun Lv 1 2 pts. 9,766
  9. Avatar for alyssa_d_V2.0 49. alyssa_d_V2.0 Lv 1 2 pts. 9,750
  10. Avatar for equilibria 50. equilibria Lv 1 2 pts. 9,740

Comments