Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,187
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,175
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 10,137
  4. Avatar for Contenders 4. Contenders 24 pts. 10,092
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 10,080
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,055
  7. Avatar for Australia 7. Australia 4 pts. 10,031
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 10,026
  9. Avatar for VeFold 9. VeFold 1 pt. 9,970
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 9,910
  1. Avatar for Zhang Ruichong 41. Zhang Ruichong Lv 1 5 pts. 9,819
  2. Avatar for ppp6 42. ppp6 Lv 1 4 pts. 9,812
  3. Avatar for abiogenesis 43. abiogenesis Lv 1 4 pts. 9,811
  4. Avatar for matt61ger 44. matt61ger Lv 1 3 pts. 9,786
  5. Avatar for heather-1 45. heather-1 Lv 1 3 pts. 9,784
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 3 pts. 9,775
  7. Avatar for ivalnic 47. ivalnic Lv 1 3 pts. 9,769
  8. Avatar for Th1sN@me!sN0tAPun 48. Th1sN@me!sN0tAPun Lv 1 2 pts. 9,766
  9. Avatar for alyssa_d_V2.0 49. alyssa_d_V2.0 Lv 1 2 pts. 9,750
  10. Avatar for equilibria 50. equilibria Lv 1 2 pts. 9,740

Comments