Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 9,819
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,750
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,140

  1. Avatar for frostschutz 61. frostschutz Lv 1 1 pt. 9,513
  2. Avatar for Mohoernchen 62. Mohoernchen Lv 1 1 pt. 9,484
  3. Avatar for carxo 63. carxo Lv 1 1 pt. 9,392
  4. Avatar for zo3xiaJonWeinberg 64. zo3xiaJonWeinberg Lv 1 1 pt. 9,342
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 9,315
  6. Avatar for DScott 66. DScott Lv 1 1 pt. 9,312
  7. Avatar for B. A. Beder 67. B. A. Beder Lv 1 1 pt. 9,292
  8. Avatar for EIIisTAB2 68. EIIisTAB2 Lv 1 1 pt. 9,283
  9. Avatar for RWoodcock 69. RWoodcock Lv 1 1 pt. 9,282
  10. Avatar for Plasmadoc 70. Plasmadoc Lv 1 1 pt. 9,279

Comments