Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,187
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,175
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 10,137
  4. Avatar for Contenders 4. Contenders 24 pts. 10,092
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 10,080
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,055
  7. Avatar for Australia 7. Australia 4 pts. 10,031
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 10,026
  9. Avatar for VeFold 9. VeFold 1 pt. 9,970
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 9,910
  1. Avatar for frostschutz 61. frostschutz Lv 1 1 pt. 9,513
  2. Avatar for Mohoernchen 62. Mohoernchen Lv 1 1 pt. 9,484
  3. Avatar for carxo 63. carxo Lv 1 1 pt. 9,392
  4. Avatar for zo3xiaJonWeinberg 64. zo3xiaJonWeinberg Lv 1 1 pt. 9,342
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 9,315
  6. Avatar for DScott 66. DScott Lv 1 1 pt. 9,312
  7. Avatar for B. A. Beder 67. B. A. Beder Lv 1 1 pt. 9,292
  8. Avatar for EIIisTAB2 68. EIIisTAB2 Lv 1 1 pt. 9,283
  9. Avatar for RWoodcock 69. RWoodcock Lv 1 1 pt. 9,282
  10. Avatar for Plasmadoc 70. Plasmadoc Lv 1 1 pt. 9,279

Comments