Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 18,695
  2. Avatar for I-14 Salt Bridges 12. I-14 Salt Bridges 1 pt. 18,589
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 18,566
  1. Avatar for futsall 61. futsall Lv 1 1 pt. 17,835
  2. Avatar for pro_stealth 62. pro_stealth Lv 1 1 pt. 17,832
  3. Avatar for Swapper242 63. Swapper242 Lv 1 1 pt. 17,807
  4. Avatar for furi0us 64. furi0us Lv 1 1 pt. 17,756
  5. Avatar for ivalnic 65. ivalnic Lv 1 1 pt. 14,617
  6. Avatar for PhilKania 66. PhilKania Lv 1 1 pt. 14,153
  7. Avatar for beta_helix 67. beta_helix Lv 1 1 pt. 14,150
  8. Avatar for Tenlocket 68. Tenlocket Lv 1 1 pt. 14,150
  9. Avatar for danil1247 69. danil1247 Lv 1 1 pt. 14,150
  10. Avatar for Tea_Cheurte 70. Tea_Cheurte Lv 1 1 pt. 14,150

Comments