Icon representing a puzzle

2525: Revisiting Puzzle 77: Copper Chaperone

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 23, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,370
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 9,316
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,498
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,257
  1. Avatar for gmn 11. gmn Lv 1 54 pts. 10,020
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 51 pts. 9,980
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 48 pts. 9,975
  4. Avatar for fpc 14. fpc Lv 1 45 pts. 9,958
  5. Avatar for WBarme1234 15. WBarme1234 Lv 1 42 pts. 9,926
  6. Avatar for Punzi Baker 3 16. Punzi Baker 3 Lv 1 39 pts. 9,923
  7. Avatar for Idiotboy 17. Idiotboy Lv 1 36 pts. 9,871
  8. Avatar for rosie4loop 18. rosie4loop Lv 1 34 pts. 9,868
  9. Avatar for TheGUmmer 19. TheGUmmer Lv 1 31 pts. 9,859
  10. Avatar for akaaka 20. akaaka Lv 1 29 pts. 9,815

Comments