Icon representing a puzzle

2525: Revisiting Puzzle 77: Copper Chaperone

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 23, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,370
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 9,316
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,498
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,257
  1. Avatar for g_b 21. g_b Lv 1 27 pts. 9,795
  2. Avatar for heather-1 22. heather-1 Lv 1 25 pts. 9,733
  3. Avatar for roarshock 23. roarshock Lv 1 23 pts. 9,726
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 22 pts. 9,703
  5. Avatar for Hellcat6 25. Hellcat6 Lv 1 20 pts. 9,663
  6. Avatar for hookedwarm 26. hookedwarm Lv 1 18 pts. 9,656
  7. Avatar for drumpeter18yrs9yrs 27. drumpeter18yrs9yrs Lv 1 17 pts. 9,652
  8. Avatar for EmelendezTAMUCT 28. EmelendezTAMUCT Lv 1 16 pts. 9,648
  9. Avatar for alcor29 29. alcor29 Lv 1 14 pts. 9,608
  10. Avatar for jausmh 30. jausmh Lv 1 13 pts. 9,582

Comments