Icon representing a puzzle

2525: Revisiting Puzzle 77: Copper Chaperone

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
October 23, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,370
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 9,316
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,498
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,257

  1. Avatar for turbolag 31. turbolag Lv 1 12 pts. 9,579
  2. Avatar for Larini 32. Larini Lv 1 11 pts. 9,574
  3. Avatar for BarrySampson 33. BarrySampson Lv 1 10 pts. 9,547
  4. Avatar for manu8170 34. manu8170 Lv 1 9 pts. 9,546
  5. Avatar for meatexplosion 35. meatexplosion Lv 1 9 pts. 9,544
  6. Avatar for NPrincipi 36. NPrincipi Lv 1 8 pts. 9,518
  7. Avatar for carsonfb 37. carsonfb Lv 1 7 pts. 9,484
  8. Avatar for lancetime 38. lancetime Lv 1 7 pts. 9,473
  9. Avatar for pfirth 39. pfirth Lv 1 6 pts. 9,422
  10. Avatar for Dr.Sillem 40. Dr.Sillem Lv 1 5 pts. 9,411

Comments