Icon representing a puzzle

2525: Revisiting Puzzle 77: Copper Chaperone

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 23, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,370
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 9,316
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,498
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,257
  1. Avatar for nicobul 51. nicobul Lv 1 2 pts. 9,237
  2. Avatar for maithra 52. maithra Lv 1 2 pts. 9,233
  3. Avatar for Trajan464 53. Trajan464 Lv 1 1 pt. 9,223
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 9,159
  5. Avatar for Patatoman13 55. Patatoman13 Lv 1 1 pt. 9,153
  6. Avatar for avarius1 56. avarius1 Lv 1 1 pt. 9,112
  7. Avatar for zbp 57. zbp Lv 1 1 pt. 9,078
  8. Avatar for The Cleric 58. The Cleric Lv 1 1 pt. 9,072
  9. Avatar for DScott 59. DScott Lv 1 1 pt. 9,011
  10. Avatar for krzycho7 60. krzycho7 Lv 1 1 pt. 8,950

Comments