Icon representing a puzzle

2525: Revisiting Puzzle 77: Copper Chaperone

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
October 23, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,370
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 9,316
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,498
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,257

  1. Avatar for KRUK94 61. KRUK94 Lv 1 1 pt. 8,900
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 8,829
  3. Avatar for HudT 63. HudT Lv 1 1 pt. 8,821
  4. Avatar for frostschutz 64. frostschutz Lv 1 1 pt. 8,820
  5. Avatar for ramlov6 65. ramlov6 Lv 1 1 pt. 8,771
  6. Avatar for efull 66. efull Lv 1 1 pt. 8,686
  7. Avatar for snchanad 67. snchanad Lv 1 1 pt. 8,671
  8. Avatar for Merf 68. Merf Lv 1 1 pt. 8,662
  9. Avatar for WuWTq 69. WuWTq Lv 1 1 pt. 8,659
  10. Avatar for Arlind1 70. Arlind1 Lv 1 1 pt. 8,579

Comments