Icon representing a puzzle

2525: Revisiting Puzzle 77: Copper Chaperone

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 23, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,370
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 9,316
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,498
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,257
  1. Avatar for yuanhhh 81. yuanhhh Lv 1 1 pt. 7,912
  2. Avatar for Jhondoe 82. Jhondoe Lv 1 1 pt. 6,594
  3. Avatar for katelinr 83. katelinr Lv 1 1 pt. 6,536
  4. Avatar for wyrobekj 84. wyrobekj Lv 1 1 pt. 6,526
  5. Avatar for Ege 85. Ege Lv 1 1 pt. 6,482
  6. Avatar for martinabonatti 86. martinabonatti Lv 1 1 pt. 6,482
  7. Avatar for Altercomp 87. Altercomp Lv 1 1 pt. 6,482

Comments