Icon representing a puzzle

2525: Revisiting Puzzle 77: Copper Chaperone

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 23, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,388
  2. Avatar for Go Science 2. Go Science 68 pts. 10,241
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 10,178
  4. Avatar for Australia 4. Australia 27 pts. 10,049
  5. Avatar for Contenders 5. Contenders 16 pts. 10,021
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 9,926
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 9,859
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 9,703
  9. Avatar for VeFold 9. VeFold 1 pt. 9,656
  10. Avatar for I-14 Salt Bridges 10. I-14 Salt Bridges 1 pt. 9,648
  1. Avatar for JuliaBCollet 41. JuliaBCollet Lv 1 5 pts. 9,383
  2. Avatar for alyssa_d_V2.0 42. alyssa_d_V2.0 Lv 1 4 pts. 9,370
  3. Avatar for abiogenesis 43. abiogenesis Lv 1 4 pts. 9,364
  4. Avatar for jamiexq 44. jamiexq Lv 1 4 pts. 9,343
  5. Avatar for pizpot 45. pizpot Lv 1 3 pts. 9,335
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 3 pts. 9,333
  7. Avatar for zanbato 47. zanbato Lv 1 3 pts. 9,316
  8. Avatar for carxo 48. carxo Lv 1 2 pts. 9,265
  9. Avatar for muffnerk 49. muffnerk Lv 1 2 pts. 9,249
  10. Avatar for Th1sN@me!sN0tAPun 50. Th1sN@me!sN0tAPun Lv 1 2 pts. 9,240

Comments