Icon representing a puzzle

2525: Revisiting Puzzle 77: Copper Chaperone

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 23, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,388
  2. Avatar for Go Science 2. Go Science 68 pts. 10,241
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 10,178
  4. Avatar for Australia 4. Australia 27 pts. 10,049
  5. Avatar for Contenders 5. Contenders 16 pts. 10,021
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 9,926
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 9,859
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 9,703
  9. Avatar for VeFold 9. VeFold 1 pt. 9,656
  10. Avatar for I-14 Salt Bridges 10. I-14 Salt Bridges 1 pt. 9,648
  1. Avatar for Sammy3c2b1a0 71. Sammy3c2b1a0 Lv 1 1 pt. 8,498
  2. Avatar for Maucoucou 72. Maucoucou Lv 1 1 pt. 8,493
  3. Avatar for webb223a 73. webb223a Lv 1 1 pt. 8,443
  4. Avatar for futsall 74. futsall Lv 1 1 pt. 8,415
  5. Avatar for ivalnic 75. ivalnic Lv 1 1 pt. 8,405
  6. Avatar for furi0us 76. furi0us Lv 1 1 pt. 8,334
  7. Avatar for Swapper242 77. Swapper242 Lv 1 1 pt. 8,329
  8. Avatar for Kyrylo 78. Kyrylo Lv 1 1 pt. 8,257
  9. Avatar for Jia58 79. Jia58 Lv 1 1 pt. 8,252
  10. Avatar for pro_stealth 80. pro_stealth Lv 1 1 pt. 8,043

Comments