Icon representing a puzzle

2534: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 13, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,982
  2. Avatar for Go Science 2. Go Science 65 pts. 10,806
  3. Avatar for Void Crushers 3. Void Crushers 41 pts. 10,668
  4. Avatar for Contenders 4. Contenders 24 pts. 10,654
  5. Avatar for Australia 5. Australia 14 pts. 10,526
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,483
  7. Avatar for VeFold 7. VeFold 4 pts. 10,405
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 10,354
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,325
  10. Avatar for I-14 Salt Bridges 10. I-14 Salt Bridges 1 pt. 10,001
  1. Avatar for AlkiP0Ps 11. AlkiP0Ps Lv 1 55 pts. 10,526
  2. Avatar for christioanchauvin 12. christioanchauvin Lv 1 51 pts. 10,483
  3. Avatar for g_b 13. g_b Lv 1 48 pts. 10,482
  4. Avatar for blazegeek 14. blazegeek Lv 1 45 pts. 10,460
  5. Avatar for meatexplosion 15. meatexplosion Lv 1 42 pts. 10,452
  6. Avatar for gmn 16. gmn Lv 1 39 pts. 10,450
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 37 pts. 10,421
  8. Avatar for akaaka 18. akaaka Lv 1 34 pts. 10,419
  9. Avatar for BarrySampson 19. BarrySampson Lv 1 32 pts. 10,405
  10. Avatar for fpc 20. fpc Lv 1 30 pts. 10,354

Comments