Icon representing a puzzle

2534: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 13, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,982
  2. Avatar for Go Science 2. Go Science 65 pts. 10,806
  3. Avatar for Void Crushers 3. Void Crushers 41 pts. 10,668
  4. Avatar for Contenders 4. Contenders 24 pts. 10,654
  5. Avatar for Australia 5. Australia 14 pts. 10,526
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,483
  7. Avatar for VeFold 7. VeFold 4 pts. 10,405
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 10,354
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,325
  10. Avatar for I-14 Salt Bridges 10. I-14 Salt Bridges 1 pt. 10,001
  1. Avatar for Hellcat6 51. Hellcat6 Lv 1 2 pts. 9,875
  2. Avatar for Trajan464 52. Trajan464 Lv 1 2 pts. 9,850
  3. Avatar for EmelendezTAMUCT 53. EmelendezTAMUCT Lv 1 2 pts. 9,841
  4. Avatar for Crossed Sticks 54. Crossed Sticks Lv 1 1 pt. 9,838
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 9,790
  6. Avatar for dahast.de 56. dahast.de Lv 1 1 pt. 9,789
  7. Avatar for roarshock 57. roarshock Lv 1 1 pt. 9,772
  8. Avatar for KRUK94 58. KRUK94 Lv 1 1 pt. 9,745
  9. Avatar for sitlux 59. sitlux Lv 1 1 pt. 9,669
  10. Avatar for DScott 60. DScott Lv 1 1 pt. 9,639

Comments