Icon representing a puzzle

2534: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 13, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,982
  2. Avatar for Go Science 2. Go Science 65 pts. 10,806
  3. Avatar for Void Crushers 3. Void Crushers 41 pts. 10,668
  4. Avatar for Contenders 4. Contenders 24 pts. 10,654
  5. Avatar for Australia 5. Australia 14 pts. 10,526
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,483
  7. Avatar for VeFold 7. VeFold 4 pts. 10,405
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 10,354
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,325
  10. Avatar for I-14 Salt Bridges 10. I-14 Salt Bridges 1 pt. 10,001
  1. Avatar for jamiexq 31. jamiexq Lv 1 13 pts. 10,204
  2. Avatar for ProfVince 32. ProfVince Lv 1 12 pts. 10,176
  3. Avatar for maithra 33. maithra Lv 1 11 pts. 10,155
  4. Avatar for rizwad 34. rizwad Lv 1 10 pts. 10,148
  5. Avatar for goldfish80 35. goldfish80 Lv 1 9 pts. 10,144
  6. Avatar for Larini 36. Larini Lv 1 8 pts. 10,131
  7. Avatar for RichGuilmain 37. RichGuilmain Lv 1 7 pts. 10,122
  8. Avatar for Alistair69 38. Alistair69 Lv 1 7 pts. 10,115
  9. Avatar for heather-1 39. heather-1 Lv 1 6 pts. 10,067
  10. Avatar for ComradeTurtle 40. ComradeTurtle Lv 1 6 pts. 10,059

Comments