Icon representing a puzzle

2534: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 13, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,982
  2. Avatar for Go Science 2. Go Science 65 pts. 10,806
  3. Avatar for Void Crushers 3. Void Crushers 41 pts. 10,668
  4. Avatar for Contenders 4. Contenders 24 pts. 10,654
  5. Avatar for Australia 5. Australia 14 pts. 10,526
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,483
  7. Avatar for VeFold 7. VeFold 4 pts. 10,405
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 10,354
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,325
  10. Avatar for I-14 Salt Bridges 10. I-14 Salt Bridges 1 pt. 10,001
  1. Avatar for sesamecrabmeat 71. sesamecrabmeat Lv 1 1 pt. 9,258
  2. Avatar for orily1337 72. orily1337 Lv 1 1 pt. 9,256
  3. Avatar for isa03 73. isa03 Lv 1 1 pt. 9,249
  4. Avatar for Fagus sylvatica 74. Fagus sylvatica Lv 1 1 pt. 9,248
  5. Avatar for RWoodcock 75. RWoodcock Lv 1 1 pt. 9,220
  6. Avatar for Kh.Rustamov 76. Kh.Rustamov Lv 1 1 pt. 9,205
  7. Avatar for lyricalcarpenter 77. lyricalcarpenter Lv 1 1 pt. 9,124
  8. Avatar for efull 78. efull Lv 1 1 pt. 9,116
  9. Avatar for DipsyDoodle2016 79. DipsyDoodle2016 Lv 1 1 pt. 9,062
  10. Avatar for TAMUCT_Dawg 80. TAMUCT_Dawg Lv 1 1 pt. 8,895

Comments