Icon representing a puzzle

2537: Revisiting Puzzle 82: Cytotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 20, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,257
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 7,501
  3. Avatar for I-14 Salt Bridges 13. I-14 Salt Bridges 1 pt. 7,496
  4. Avatar for Androids 14. Androids 1 pt. 7,480
  1. Avatar for WBarme1234 11. WBarme1234 Lv 1 50 pts. 10,011
  2. Avatar for BarrySampson 12. BarrySampson Lv 1 46 pts. 10,005
  3. Avatar for gmn 13. gmn Lv 1 43 pts. 9,992
  4. Avatar for alcor29 14. alcor29 Lv 1 40 pts. 9,990
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 37 pts. 9,977
  6. Avatar for g_b 16. g_b Lv 1 34 pts. 9,959
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 31 pts. 9,942
  8. Avatar for AlkiP0Ps 18. AlkiP0Ps Lv 1 29 pts. 9,936
  9. Avatar for akaaka 19. akaaka Lv 1 26 pts. 9,882
  10. Avatar for BootsMcGraw 20. BootsMcGraw Lv 1 24 pts. 9,874

Comments