Icon representing a puzzle

2537: Revisiting Puzzle 82: Cytotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 20, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,387
  2. Avatar for Go Science 2. Go Science 68 pts. 10,370
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,189
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,052
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,011
  6. Avatar for VeFold 6. VeFold 9 pts. 10,005
  7. Avatar for Contenders 7. Contenders 5 pts. 9,942
  8. Avatar for Australia 8. Australia 3 pts. 9,936
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,674
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,467
  1. Avatar for WBarme1234 11. WBarme1234 Lv 1 50 pts. 10,011
  2. Avatar for BarrySampson 12. BarrySampson Lv 1 46 pts. 10,005
  3. Avatar for gmn 13. gmn Lv 1 43 pts. 9,992
  4. Avatar for alcor29 14. alcor29 Lv 1 40 pts. 9,990
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 37 pts. 9,977
  6. Avatar for g_b 16. g_b Lv 1 34 pts. 9,959
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 31 pts. 9,942
  8. Avatar for AlkiP0Ps 18. AlkiP0Ps Lv 1 29 pts. 9,936
  9. Avatar for akaaka 19. akaaka Lv 1 26 pts. 9,882
  10. Avatar for BootsMcGraw 20. BootsMcGraw Lv 1 24 pts. 9,874

Comments