Icon representing a puzzle

2537: Revisiting Puzzle 82: Cytotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 20, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,257
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 7,501
  3. Avatar for I-14 Salt Bridges 13. I-14 Salt Bridges 1 pt. 7,496
  4. Avatar for Androids 14. Androids 1 pt. 7,480
  1. Avatar for Dr.Sillem 41. Dr.Sillem Lv 1 3 pts. 9,055
  2. Avatar for carsonfb 42. carsonfb Lv 1 3 pts. 9,029
  3. Avatar for hada 43. hada Lv 1 2 pts. 8,984
  4. Avatar for nicobul 44. nicobul Lv 1 2 pts. 8,952
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 2 pts. 8,925
  6. Avatar for jamiexq 46. jamiexq Lv 1 2 pts. 8,831
  7. Avatar for zbp 47. zbp Lv 1 1 pt. 8,675
  8. Avatar for Mohoernchen 48. Mohoernchen Lv 1 1 pt. 8,657
  9. Avatar for phi16 49. phi16 Lv 1 1 pt. 8,648
  10. Avatar for vybi 50. vybi Lv 1 1 pt. 8,626

Comments