Icon representing a puzzle

2537: Revisiting Puzzle 82: Cytotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
November 20, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,387
  2. Avatar for Go Science 2. Go Science 68 pts. 10,370
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,189
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,052
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,011
  6. Avatar for VeFold 6. VeFold 9 pts. 10,005
  7. Avatar for Contenders 7. Contenders 5 pts. 9,942
  8. Avatar for Australia 8. Australia 3 pts. 9,936
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,674
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,467

  1. Avatar for Dr.Sillem 41. Dr.Sillem Lv 1 3 pts. 9,055
  2. Avatar for carsonfb 42. carsonfb Lv 1 3 pts. 9,029
  3. Avatar for hada 43. hada Lv 1 2 pts. 8,984
  4. Avatar for nicobul 44. nicobul Lv 1 2 pts. 8,952
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 2 pts. 8,925
  6. Avatar for jamiexq 46. jamiexq Lv 1 2 pts. 8,831
  7. Avatar for zbp 47. zbp Lv 1 1 pt. 8,675
  8. Avatar for Mohoernchen 48. Mohoernchen Lv 1 1 pt. 8,657
  9. Avatar for phi16 49. phi16 Lv 1 1 pt. 8,648
  10. Avatar for vybi 50. vybi Lv 1 1 pt. 8,626

Comments