Icon representing a puzzle

2537: Revisiting Puzzle 82: Cytotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 20, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,257
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 7,501
  3. Avatar for I-14 Salt Bridges 13. I-14 Salt Bridges 1 pt. 7,496
  4. Avatar for Androids 14. Androids 1 pt. 7,480
  1. Avatar for Diumberm 61. Diumberm Lv 1 1 pt. 8,018
  2. Avatar for vv7r 62. vv7r Lv 1 1 pt. 7,989
  3. Avatar for DipsyDoodle2016 63. DipsyDoodle2016 Lv 1 1 pt. 7,906
  4. Avatar for reedb 64. reedb Lv 1 1 pt. 7,876
  5. Avatar for futsall 65. futsall Lv 1 1 pt. 7,863
  6. Avatar for Swapper242 66. Swapper242 Lv 1 1 pt. 7,817
  7. Avatar for hookedwarm 67. hookedwarm Lv 1 1 pt. 7,813
  8. Avatar for furi0us 68. furi0us Lv 1 1 pt. 7,564
  9. Avatar for Vinara 69. Vinara Lv 1 1 pt. 7,545
  10. Avatar for Tempaccuount 70. Tempaccuount Lv 1 1 pt. 7,501

Comments