Icon representing a puzzle

2537: Revisiting Puzzle 82: Cytotoxin

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 20, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,387
  2. Avatar for Go Science 2. Go Science 68 pts. 10,370
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,189
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,052
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,011
  6. Avatar for VeFold 6. VeFold 9 pts. 10,005
  7. Avatar for Contenders 7. Contenders 5 pts. 9,942
  8. Avatar for Australia 8. Australia 3 pts. 9,936
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,674
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,467

  1. Avatar for Diumberm 61. Diumberm Lv 1 1 pt. 8,018
  2. Avatar for vv7r 62. vv7r Lv 1 1 pt. 7,989
  3. Avatar for DipsyDoodle2016 63. DipsyDoodle2016 Lv 1 1 pt. 7,906
  4. Avatar for reedb 64. reedb Lv 1 1 pt. 7,876
  5. Avatar for futsall 65. futsall Lv 1 1 pt. 7,863
  6. Avatar for Swapper242 66. Swapper242 Lv 1 1 pt. 7,817
  7. Avatar for hookedwarm 67. hookedwarm Lv 1 1 pt. 7,813
  8. Avatar for furi0us 68. furi0us Lv 1 1 pt. 7,564
  9. Avatar for Vinara 69. Vinara Lv 1 1 pt. 7,545
  10. Avatar for Tempaccuount 70. Tempaccuount Lv 1 1 pt. 7,501

Comments