Icon representing a puzzle

2537: Revisiting Puzzle 82: Cytotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 20, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,387
  2. Avatar for Go Science 2. Go Science 68 pts. 10,370
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,189
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,052
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,011
  6. Avatar for VeFold 6. VeFold 9 pts. 10,005
  7. Avatar for Contenders 7. Contenders 5 pts. 9,942
  8. Avatar for Australia 8. Australia 3 pts. 9,936
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,674
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,467
  1. Avatar for drumpeter18yrs9yrs 31. drumpeter18yrs9yrs Lv 1 9 pts. 9,542
  2. Avatar for ucad 32. ucad Lv 1 8 pts. 9,533
  3. Avatar for Hellcat6 33. Hellcat6 Lv 1 7 pts. 9,530
  4. Avatar for alyssa_d_V2.0 34. alyssa_d_V2.0 Lv 1 6 pts. 9,467
  5. Avatar for jausmh 35. jausmh Lv 1 6 pts. 9,407
  6. Avatar for Th1sN@me!sN0tAPun 36. Th1sN@me!sN0tAPun Lv 1 5 pts. 9,404
  7. Avatar for rosie4loop 37. rosie4loop Lv 1 5 pts. 9,258
  8. Avatar for georg137 38. georg137 Lv 1 4 pts. 9,232
  9. Avatar for ProfVince 39. ProfVince Lv 1 4 pts. 9,176
  10. Avatar for Larini 40. Larini Lv 1 3 pts. 9,176

Comments