2545: Refine Density Reconstruction 16
Closed since over 1 year ago
Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron DensitySummary
- Created
- November 21, 2024
- Expires
- Max points
- 100
This is a protein we've given before in puzzle 2300, which was Reconstruction Puzzle 39, but now we have the Refine Density tool available to make folds even better!
- Sequence
- GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR