Icon representing a puzzle

2540: Revisiting Puzzle 83: Cardiotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
November 27, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 7,247
  2. Avatar for CBME5920_2022 12. CBME5920_2022 1 pt. 7,178
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 7,110

  1. Avatar for orily1337 11. orily1337 Lv 1 50 pts. 10,157
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 47 pts. 10,150
  3. Avatar for grogar7 13. grogar7 Lv 1 43 pts. 10,119
  4. Avatar for WBarme1234 14. WBarme1234 Lv 1 40 pts. 10,099
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 37 pts. 10,052
  6. Avatar for TheGUmmer 16. TheGUmmer Lv 1 34 pts. 10,030
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 32 pts. 9,950
  8. Avatar for g_b 18. g_b Lv 1 29 pts. 9,915
  9. Avatar for heather-1 19. heather-1 Lv 1 27 pts. 9,898
  10. Avatar for alcor29 20. alcor29 Lv 1 25 pts. 9,897

Comments