Icon representing a puzzle

2540: Revisiting Puzzle 83: Cardiotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 27, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,416
  2. Avatar for Go Science 2. Go Science 68 pts. 10,382
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,230
  4. Avatar for Contenders 4. Contenders 27 pts. 10,166
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,157
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,099
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 10,030
  8. Avatar for VeFold 8. VeFold 3 pts. 9,930
  9. Avatar for Australia 9. Australia 1 pt. 9,631
  10. Avatar for Team China 10. Team China 1 pt. 7,326
  1. Avatar for orily1337 11. orily1337 Lv 1 50 pts. 10,157
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 47 pts. 10,150
  3. Avatar for grogar7 13. grogar7 Lv 1 43 pts. 10,119
  4. Avatar for WBarme1234 14. WBarme1234 Lv 1 40 pts. 10,099
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 37 pts. 10,052
  6. Avatar for TheGUmmer 16. TheGUmmer Lv 1 34 pts. 10,030
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 32 pts. 9,950
  8. Avatar for g_b 18. g_b Lv 1 29 pts. 9,915
  9. Avatar for heather-1 19. heather-1 Lv 1 27 pts. 9,898
  10. Avatar for alcor29 20. alcor29 Lv 1 25 pts. 9,897

Comments