Icon representing a puzzle

2540: Revisiting Puzzle 83: Cardiotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 27, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 7,247
  2. Avatar for CBME5920_2022 12. CBME5920_2022 1 pt. 7,178
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 7,110
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 0
  1. Avatar for BarrySampson 21. BarrySampson Lv 1 23 pts. 9,875
  2. Avatar for fpc 22. fpc Lv 1 21 pts. 9,865
  3. Avatar for georg137 23. georg137 Lv 1 19 pts. 9,793
  4. Avatar for Vinara 24. Vinara Lv 1 17 pts. 9,777
  5. Avatar for Galaxie 25. Galaxie Lv 1 16 pts. 9,730
  6. Avatar for ucad 26. ucad Lv 1 15 pts. 9,709
  7. Avatar for AlkiP0Ps 27. AlkiP0Ps Lv 1 13 pts. 9,631
  8. Avatar for pfirth 28. pfirth Lv 1 12 pts. 9,563
  9. Avatar for hookedwarm 29. hookedwarm Lv 1 11 pts. 9,558
  10. Avatar for ProfVince 30. ProfVince Lv 1 10 pts. 9,495

Comments