Icon representing a puzzle

2540: Revisiting Puzzle 83: Cardiotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 27, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,416
  2. Avatar for Go Science 2. Go Science 68 pts. 10,382
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,230
  4. Avatar for Contenders 4. Contenders 27 pts. 10,166
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,157
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,099
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 10,030
  8. Avatar for VeFold 8. VeFold 3 pts. 9,930
  9. Avatar for Australia 9. Australia 1 pt. 9,631
  10. Avatar for Team China 10. Team China 1 pt. 7,326
  1. Avatar for BarrySampson 21. BarrySampson Lv 1 23 pts. 9,875
  2. Avatar for fpc 22. fpc Lv 1 21 pts. 9,865
  3. Avatar for georg137 23. georg137 Lv 1 19 pts. 9,793
  4. Avatar for Vinara 24. Vinara Lv 1 17 pts. 9,777
  5. Avatar for Galaxie 25. Galaxie Lv 1 16 pts. 9,730
  6. Avatar for ucad 26. ucad Lv 1 15 pts. 9,709
  7. Avatar for AlkiP0Ps 27. AlkiP0Ps Lv 1 13 pts. 9,631
  8. Avatar for pfirth 28. pfirth Lv 1 12 pts. 9,563
  9. Avatar for hookedwarm 29. hookedwarm Lv 1 11 pts. 9,558
  10. Avatar for ProfVince 30. ProfVince Lv 1 10 pts. 9,495

Comments